RNF19B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2085046
Article Name: RNF19B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2085046
Supplier Catalog Number: orb2085046
Alternative Catalog Number: BYT-ORB2085046-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RNF19B
Conjugation: Biotin
Alternative Names: NKLAM, IBRDC3
RNF19B Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 80kDa
UniProt: Q6ZMZ0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VHAQMAENEEEGSGGGGSEEDPPCRHQSCEQKDCLASKPWDISLAQPESI