R3HCC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2085091
| Article Name: |
R3HCC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2085091 |
| Supplier Catalog Number: |
orb2085091 |
| Alternative Catalog Number: |
BYT-ORB2085091-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human R3HCC1 |
| Conjugation: |
Biotin |
| R3HCC1 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
28kDa |
| NCBI: |
001129580 |
| UniProt: |
Q9Y3T6 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: VDDTHALGIFPCLASAAEALTREFSVLKIRPLTQGTKQSKLKALQRPKLL |
