PRAMEF7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2085169
Article Name: PRAMEF7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2085169
Supplier Catalog Number: orb2085169
Alternative Catalog Number: BYT-ORB2085169-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PRAMEF7
Conjugation: Biotin
PRAMEF7 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 52kDa
NCBI: 001012277
UniProt: Q5VXH5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ATASFPEALSQKQTADNCPGTGRQQPFMVFIDLCLKNRTLDECLTHLLEW