OR52W1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2085277
Article Name: OR52W1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2085277
Supplier Catalog Number: orb2085277
Alternative Catalog Number: BYT-ORB2085277-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR52W1
Conjugation: Biotin
Alternative Names: OR11-71, OR52W1P
OR52W1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 001005178
UniProt: Q6IF63
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VVELVVGNTQATNLYGLALSLAISGMDILGITGSYGLIAHAVLQLPTREA