OR51I2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2085310
Article Name: OR51I2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2085310
Supplier Catalog Number: orb2085310
Alternative Catalog Number: BYT-ORB2085310-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR51I2
Conjugation: Biotin
Alternative Names: OR11-38
OR51I2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 001004754
UniProt: Q9H344
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FFIFLSYVLILRSVMATASREERLKALNTCVSHILAVLAFYVPMIGVSTV