OR8U9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2085418
Article Name: OR8U9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2085418
Supplier Catalog Number: orb2085418
Alternative Catalog Number: BYT-ORB2085418-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR8U9
Conjugation: Biotin
OR8U9 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 001013375
UniProt: P0C7N5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LIFMYLQPSSSHALDTDKMASVFYTVIIPMLNPLIYSLQNKEVKEALKKI