OR5H14 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2085547
Article Name: OR5H14 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2085547
Supplier Catalog Number: orb2085547
Alternative Catalog Number: BYT-ORB2085547-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human OR5H14
Conjugation: Biotin
OR5H14 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 001005514
UniProt: A6NHG9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LYYGPLVFMYVGSASPQADDQDMMESLFYTVIVPLLNSMIYSLRNKQVIA