OR4D10 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2085625
Article Name: OR4D10 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2085625
Supplier Catalog Number: orb2085625
Alternative Catalog Number: BYT-ORB2085625-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR4D10
Conjugation: Biotin
Alternative Names: OST711, OR4D10P, OR11-251
OR4D10 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 001004705
UniProt: Q8NGI6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FILELLMISNNGLLTTLWFFLLLVSYIVILSLPKSQAGEGRRKAISTCTS