NBPF7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2085802
Article Name: NBPF7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2085802
Supplier Catalog Number: orb2085802
Alternative Catalog Number: BYT-ORB2085802-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human NBPF7
Conjugation: Biotin
Alternative Names: NBPF7
NBPF7 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 46kDa
NCBI: 001041445
UniProt: P0C2Y1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: NPPHKN target=_blank>ELDKVQESPAPREEQKAEEKEVPEDSLEECAITYSNSHGPSDSNPPHKN