MZT1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2085820
Article Name: MZT1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2085820
Supplier Catalog Number: orb2085820
Alternative Catalog Number: BYT-ORB2085820-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MZT1
Conjugation: Biotin
Alternative Names: MOZART1, C13orf37
MZT1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 9kDa
NCBI: 001065243
UniProt: Q08AG7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LLEISRILNTGLDMETLSICVRLCEQGINPEALSSVIKELRKATEALKAA