MRPS25 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2085850
Article Name: MRPS25 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2085850
Supplier Catalog Number: orb2085850
Alternative Catalog Number: BYT-ORB2085850-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human MRPS25
Conjugation: Biotin
Alternative Names: RPMS25, COXPD50, MRP-S25
MRPS25 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 12kDa
NCBI: 071942
UniProt: P82663
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: YKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKIL