MRPS18C Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2085856
| Article Name: |
MRPS18C Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2085856 |
| Supplier Catalog Number: |
orb2085856 |
| Alternative Catalog Number: |
BYT-ORB2085856-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPS18C |
| Conjugation: |
Biotin |
| Alternative Names: |
CGI-134, S18mt-c, MRPS18-1, mrps18-c, MRP-S18-1, MRP-S18-c |
| MRPS18C Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
15kDa |
| NCBI: |
057151 |
| UniProt: |
Q9Y3D5 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: FVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKD |