MOB3C Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2085889
Article Name: MOB3C Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2085889
Supplier Catalog Number: orb2085889
Alternative Catalog Number: BYT-ORB2085889-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MOB3C
Conjugation: Biotin
Alternative Names: MOB1E, MOBKL2C
MOB3C Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 25kDa
NCBI: 958805
UniProt: Q70IA8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MAGGPRYEYRWQDERQYRRPAKLSAPRYMALLMDWIEGLINDEEVFPTRV