LMAN1L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2085967
Article Name: LMAN1L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2085967
Supplier Catalog Number: orb2085967
Alternative Catalog Number: BYT-ORB2085967-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human LMAN1L
Conjugation: Biotin
Alternative Names: ERGL, ERGIC-53L
LMAN1L Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 068591
UniProt: Q9HAT1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GLSKQLAQAERQWKKQLGPPGQARPDGGWALDASCQIPSTPGRGGHLSMS