KRT39 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2086024
Article Name: KRT39 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2086024
Supplier Catalog Number: orb2086024
Alternative Catalog Number: BYT-ORB2086024-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KRT39
Conjugation: Biotin
Alternative Names: K39, KA35, CK-39
KRT39 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 998821
UniProt: Q6A163
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: NFNARFSLDDCSWYGEGINSNEKETMQILNERLANYLQKVRMLERENAEL