KLHL33 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2086042
Article Name: KLHL33 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2086042
Supplier Catalog Number: orb2086042
Alternative Catalog Number: BYT-ORB2086042-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KLHL33
Conjugation: Biotin
KLHL33 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 001103467
UniProt: A6NCF5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VRFGRMSTRELRRVRAAGLLPPLTPDLLHQLMVEADVPGQERRREPDRAL