KBTBD12 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2086132
Article Name: KBTBD12 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2086132
Supplier Catalog Number: orb2086132
Alternative Catalog Number: BYT-ORB2086132-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KBTBD12
Conjugation: Biotin
Alternative Names: KLHDC6
KBTBD12 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 70kDa
NCBI: 997218
UniProt: Q3ZCT8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FAKQIGAEDLSDRSKKYLYQHFAEVSLHEEILEIEVHQFLTLIKSDDLNI