KBTBD6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2086141
Article Name: KBTBD6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2086141
Supplier Catalog Number: orb2086141
Alternative Catalog Number: BYT-ORB2086141-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KBTBD6
Conjugation: Biotin
KBTBD6 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 76kDa
NCBI: 690867
UniProt: Q86V97
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QSREDAPRSRRLASPRGGKRPKKIHKPTVSAFFTGPEELKDTAHSAALLA