INO80C Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2086183
Article Name: INO80C Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2086183
Supplier Catalog Number: orb2086183
Alternative Catalog Number: BYT-ORB2086183-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human INO80C
Conjugation: Biotin
Alternative Names: IES6, hIes6, C18orf37
INO80C Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 21kDa
UniProt: Q6PI98
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VATTSTPGIVRNSKKRPASPSHNGSSGGGYGASKKKKASASSFAQGISME