HIST1H2AE Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2086222
Article Name: HIST1H2AE Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2086222
Supplier Catalog Number: orb2086222
Alternative Catalog Number: BYT-ORB2086222-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human HIST1H2AE
Conjugation: Biotin
Alternative Names: H2A.1, H2A.2, H2A/a, H2AC4, H2AFA, HIST1H2AE
HIST1H2AE Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 14kDa
NCBI: 066390
UniProt: P04908
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAA