HEATR8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2086234
Article Name: HEATR8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2086234
Supplier Catalog Number: orb2086234
Alternative Catalog Number: BYT-ORB2086234-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human HEATR8
Conjugation: Biotin
Alternative Names: HEATR8, C1orf175
HEATR8 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 68kDa
NCBI: 001034553
UniProt: Q68CQ1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LDLDSKDVSRPDSQGRLCPASNPILSPSSTEAPRLSSGNHPQSNSEDAFK