GTSCR1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2086255
Article Name: GTSCR1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2086255
Supplier Catalog Number: orb2086255
Alternative Catalog Number: BYT-ORB2086255-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human GTSCR1
Conjugation: Biotin
GTSCR1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 15kDa
NCBI: 001265444
UniProt: Q86UQ5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VTYTILATASQVGSFARKTHQNGDLQIRGGRGRRESTEIFQVASVTEGEE