FAM153B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2086423
Article Name: FAM153B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2086423
Supplier Catalog Number: orb2086423
Alternative Catalog Number: BYT-ORB2086423-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human FAM153B
Conjugation: Biotin
FAM153B Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 42kDa
UniProt: P0C7A2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DPATLAKQLEDSTITGSHQQMSASPSSAPAEEATEKTKVEEEVKTRKPKK