SMIM29 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2087173
Article Name: SMIM29 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2087173
Supplier Catalog Number: orb2087173
Alternative Catalog Number: BYT-ORB2087173-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human C6orf1
Conjugation: Biotin
Alternative Names: LBH, C6orf1
SMIM29 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 17kDa
NCBI: 001008704
UniProt: Q86T20
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SCSLTWETPRWYMAGRVATSTSGCHCWMSRRDLTPLPHPSEPGVLDCLGP