OR4S2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2087191
Article Name: OR4S2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2087191
Supplier Catalog Number: orb2087191
Alternative Catalog Number: BYT-ORB2087191-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR4S2
Conjugation: Biotin
Alternative Names: OR4S2P, OST725, OR11-137
OR4S2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 001004059
UniProt: Q8NH73
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VVTANSGTIALGSFVILLISYSIILVSLRKQSAEGRRKALSTCGSHIAMV