C4orf34 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2087209
Article Name: C4orf34 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2087209
Supplier Catalog Number: orb2087209
Alternative Catalog Number: BYT-ORB2087209-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human C4orf34
Conjugation: Biotin
Alternative Names: C4orf34
C4orf34 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 10kDa
NCBI: 777581
UniProt: Q96QK8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VCSHEHAMRRLINLLRQSQSYCTDTECLQELPGPSGDNGISVTMILVAWM