C8orf42 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2087230
Article Name: C8orf42 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2087230
Supplier Catalog Number: orb2087230
Alternative Catalog Number: BYT-ORB2087230-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human C8orf42
Conjugation: Biotin
Alternative Names: Inm01, TDRP1, TDRP2, C8orf42
C8orf42 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 20kDa
NCBI: 778250
UniProt: Q86YL5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EQHLLERCKSPKSKGTNLRLKEELKAEKKSGFWDNLVLKQNIQSKKPDEI