C17orf77 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2087284
Article Name: C17orf77 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2087284
Supplier Catalog Number: orb2087284
Alternative Catalog Number: BYT-ORB2087284-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human C17orf77
Conjugation: Biotin
Alternative Names: C17orf77
C17orf77 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 689673
UniProt: Q96MU5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: HVGAKEQEEPGGTQALRSCGIYCLEERTDKASHEECRERSTLGRPQCTGL