ARHGAP33 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2087428
Article Name: ARHGAP33 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2087428
Supplier Catalog Number: orb2087428
Alternative Catalog Number: BYT-ORB2087428-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human ARHGAP33
Conjugation: Biotin
Alternative Names: SNX26, TCGAP, NOMA-GAP
ARHGAP33 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 92kDa
NCBI: 001166101
UniProt: O14559
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PEPLYVNLALGPRGPSPASSSSSSPPAHPRSRSDPGPPVPRLPQKQRAPW