CASC4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2087440
Article Name: CASC4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2087440
Supplier Catalog Number: orb2087440
Alternative Catalog Number: BYT-ORB2087440-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CASC4
Conjugation: Biotin
Alternative Names: H63, CASC4
CASC4 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 816929
UniProt: A8K4R1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FQCGQQMKELRAQHEENIKKLADQFLEEQKQETQKIQSNDGKELDINNQV