C11orf52 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2087494
Article Name: C11orf52 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2087494
Supplier Catalog Number: orb2087494
Alternative Catalog Number: BYT-ORB2087494-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human C11orf52
Conjugation: Biotin
C11orf52 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 13kDa
NCBI: 542390
UniProt: Q96A22
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SNLHYADIQVCSRPHAREVKHVHLENATEYATLRFPQATPRYDSKNGTLV