R3hdm4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2087509
Article Name: R3hdm4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2087509
Supplier Catalog Number: orb2087509
Alternative Catalog Number: BYT-ORB2087509-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse R3hdm4
Conjugation: Biotin
Alternative Names: AI503502, C030046I01Rik
R3hdm4 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 818775
UniProt: Q4VBF2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MVALDNSEGGPEATPSGETRLSLPGCLPPLSGSQVKRVSASRRKQHFINQ