SLC35E1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2087755
Article Name: SLC35E1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2087755
Supplier Catalog Number: orb2087755
Alternative Catalog Number: BYT-ORB2087755-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SLC35E1
Conjugation: Biotin
SLC35E1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 079157
UniProt: Q96K37
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MMTAILGVFLYNKTKYDANQQARKHLLPVTTADLSSKERHRSPLEKPHNG