TCTN2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2087761
Article Name: TCTN2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2087761
Supplier Catalog Number: orb2087761
Alternative Catalog Number: BYT-ORB2087761-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TCTN2
Conjugation: Biotin
Alternative Names: MKS8, TECT2, JBTS24, C12orf38
TCTN2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 73kDa
NCBI: 001137322
UniProt: Q96GX1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VIPGAVLEVTVRWKRGLDWCSSNETDSFSESPCILQTLLVSASHNSSCSA