MSANTD2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2087796
Article Name: MSANTD2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2087796
Supplier Catalog Number: orb2087796
Alternative Catalog Number: BYT-ORB2087796-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MSANTD2
Conjugation: FITC
Alternative Names: C11orf61
MSANTD2 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 078907
UniProt: Q6P1R3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LAELGYERTPSQCRERIKELESDGSTMEDYSQEDWGNHSQDLHGYPTDQE