C8orf44 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2087932
Article Name: C8orf44 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2087932
Supplier Catalog Number: orb2087932
Alternative Catalog Number: BYT-ORB2087932-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human C8orf44
Conjugation: Biotin
C8orf44 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 18kDa
NCBI: 062553
UniProt: Q96CB5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: HWKGRARWLMPVIPALWEAKAGRSPEVRSSKPAWPTWRNPIFTKNTKISQ