CBWD1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2087950
Article Name: CBWD1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2087950
Supplier Catalog Number: orb2087950
Alternative Catalog Number: BYT-ORB2087950-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CBWD1
Conjugation: Biotin
Alternative Names: COBP
CBWD1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 39kDa
NCBI: 001138827
UniProt: Q9BRT8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLTEEKPDGLINEATRQ