VPS50 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2087971
| Article Name: |
VPS50 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2087971 |
| Supplier Catalog Number: |
orb2087971 |
| Alternative Catalog Number: |
BYT-ORB2087971-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CCDC132 |
| Conjugation: |
Biotin |
| Alternative Names: |
VPS54L, CCDC132 |
| VPS50 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
107kDa |
| NCBI: |
001244927 |
| UniProt: |
B3KX22 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: ELREQPSDPQAEQELINSIEQVYFSVDSFDIVKYELEKLPPVLNLQELEA |
