FIBIN Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2088310
Article Name: FIBIN Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2088310
Supplier Catalog Number: orb2088310
Alternative Catalog Number: BYT-ORB2088310-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FIBIN
Conjugation: Biotin
FIBIN Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 976249
UniProt: Q8TAL6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GDAYSNSDKSLTELESKFKQGQEQDSRQESRLNEDFLGMLVHTRSLLKET