FAM124A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2088331
Article Name: FAM124A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2088331
Supplier Catalog Number: orb2088331
Alternative Catalog Number: BYT-ORB2088331-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM124A
Conjugation: Biotin
FAM124A Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 33kDa
UniProt: Q86V42
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PLLPNPCSPISEGRWQTEDHDGNKILLQVLGGRLSVCLGDLRNQLALPQT