Fam107b Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2088343
Article Name: Fam107b Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2088343
Supplier Catalog Number: orb2088343
Alternative Catalog Number: BYT-ORB2088343-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Fam107b
Conjugation: Biotin
Fam107b Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 14kDa
NCBI: 001020205
UniProt: Q5U4F3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PELQKVMEKRRRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQK