C3orf26 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2088667
Article Name: C3orf26 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2088667
Supplier Catalog Number: orb2088667
Alternative Catalog Number: BYT-ORB2088667-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human C3orf26
Conjugation: Biotin
Alternative Names: C3orf26
C3orf26 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 001161396
UniProt: B4DUM1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EASDGEGEGDTEVMQQETVPVPVPSEKTKQPKECFLIQPKERKENTTKTR