C1QTNF8 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2088671
Article Name: C1QTNF8 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2088671
Supplier Catalog Number: orb2088671
Alternative Catalog Number: BYT-ORB2088671-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human C1QTNF8
Conjugation: HRP
Alternative Names: CTRP8, UNQ5829
C1QTNF8 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 997302
UniProt: P60827
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: AQPSERSVMQAQSLMLLLAAGDAVWVRMFQRDRDNAIYGEHGDLYITFSG