C1QL3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2088675
Article Name: C1QL3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2088675
Supplier Catalog Number: orb2088675
Alternative Catalog Number: BYT-ORB2088675-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human C1QL3
Conjugation: FITC
Alternative Names: C1ql, K100, CTRP13, C1QTNF13
C1QL3 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 001010908
UniProt: Q5VWW1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFF