C1QL2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2088678
Article Name: C1QL2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2088678
Supplier Catalog Number: orb2088678
Alternative Catalog Number: BYT-ORB2088678-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human C1QL2
Conjugation: FITC
Alternative Names: CTRP10, C1QTNF10
C1QL2 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 872334
UniProt: Q7Z5L3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GTASGVGVVGGGAGVGGDSEGEVTSALSATFSGPKIAFYVGLKSPHEGYE