B9D2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Catalog Number:
BYT-ORB2088708
| Article Name: |
B9D2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2088708 |
| Supplier Catalog Number: |
orb2088708 |
| Alternative Catalog Number: |
BYT-ORB2088708-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human B9D2 |
| Conjugation: |
FITC |
| Alternative Names: |
MKS10, MKSR2, ICIS-1, JBTS34, MKSR-2 |
| B9D2 Rabbit Polyclonal Antibody (FITC) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
19kDa |
| NCBI: |
085055 |
| UniProt: |
Q9BPU9 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: SESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFA |
