ATP6V0E2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2088713
Article Name: ATP6V0E2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2088713
Supplier Catalog Number: orb2088713
Alternative Catalog Number: BYT-ORB2088713-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ATP6V0E2
Conjugation: HRP
Alternative Names: C7orf32, ATP6V0E2L
ATP6V0E2 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 20kDa
NCBI: 660265
UniProt: Q8NHE4
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: GPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKNETI