ATAD3C Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2088717
Article Name: ATAD3C Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2088717
Supplier Catalog Number: orb2088717
Alternative Catalog Number: BYT-ORB2088717-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ATAD3C
Conjugation: FITC
ATAD3C Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 46kDa
NCBI: 001034300
UniProt: Q5T2N8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QMQEQTLQLEQQSKLKQLVNEDLRKQEESVQKHHQTFLESIRAAGTLFGE