OR3A1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2088983
Article Name: OR3A1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2088983
Supplier Catalog Number: orb2088983
Alternative Catalog Number: BYT-ORB2088983-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR3A1
Conjugation: HRP
Alternative Names: OR40, OLFRA03, OR17-40, OR17-82
OR3A1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 002541
UniProt: P47881
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: CGSHLTVVAIFYGSGIFNYMRLGSTKLSDKDKAVGIFNTVINPMLNPIIY