NUDT14 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2088992
Article Name: NUDT14 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2088992
Supplier Catalog Number: orb2088992
Alternative Catalog Number: BYT-ORB2088992-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NUDT14
Conjugation: HRP
Alternative Names: UGPP, UGPPase
NUDT14 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 803877
UniProt: O95848
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: PYLRPLTLHYRQNGAQKSWDFMKTHDSVTVLLFNSSRRSLVLVKQFRPAV